Internetters is an ICANN Accredited Registrar
Internetters Logo
A member of Nominet.uk: The UK Internet Names Organisation
Llanfairpwllgwyngyllgogerychwyrndrobwllllantysiliogogogoch.com - the longest single-word .com domain name in the world

 

 

Llanfairpwllgwyngyllgogerychwyrndrobwllllantysiliogogogoch.com is the longest single word (without hyphens) .com domain name in the world.  It was registered by Internetters on 21st October 1999.

This Welsh town actually exists and its name translates as "The church of St. Mary in the hollow of white hazel trees near the rapid whirlpool by St. Tysilio's of the red cave".

For brevity, it is understandable that many of the locals simply refer to their village as "Llanfair" www.llanfair.com or "Llanfair PG" or "Llanfairpwll" which, of course, makes for easier typing and is faster to pronounce.

Prior to October 1999 it was not possible to register .com domain names longer than 26 characters (including 4 for the .com suffix). This denied many businesses and organisations the ability to register their full trading names as a .com domain name. However in October 1999, it became possible to register domain names up to 67 characters in length (including the 4 for the .com suffix).

Companies with names such as Cheltenham and Gloucester were then able to secure their trading names
with a .com suffix www.cheltenhamandgloucester.com (27 characters).

For more information about places of interest or associated with llanfairpwllgwyngyllgogerychwyrndrobwllllantysiliogogogoch

There is a station in Wales called Gorsafawddachaidraigodanheddogleddollonpenrhynareurdraethceredigion but this is well less known.

And finally, sadly even the 67 character allowance for a .com domain name is still insufficient for the town of Tetaumatawhakatangihangakoauaotamateaurehaeaturipukapihimaungahoronukupokaiwhenuaakitanarahu
in New Zealand with a staggering 92 characters
however even this seems positively tiny compared to the town of

Krungthepmahanakornamornratanakosinmahintarayutthayamahadilokphop
nopparatrajathaniburiromudomrajaniwesmahasatharn
amornphimarnavatarnsathitsakkattiyavisanukamprasit

in Thailand which is a whopping 163 characters long so long that it doesn't even fit on one line! However whilst the New Zealand place name is recognised by the Guiness Book of Record, the Thailand name is not.

Other long names (but not place names) include words such as Pneumonoultramicroscopicsilicovolcanokoniosis (and many others) .

© Copyright Internetters Limited 1998-2003. All Rights Reserved
Internetters domain name registration and web hosting specialists since 1998